PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi01g09750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 556aa    MW: 60998.5 Da    PI: 5.7996
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi01g09750.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.4e-173784148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed++lvd+v++ G g+W+++ ++ g+ R++k+c++rw ++l
  Vradi01g09750.1 37 KGPWTSTEDDILVDYVNKNGEGNWNAVQKHTGLLRCGKSCRLRWANHL 84
                     79******************************99**********9986 PP

2Myb_DNA-binding48.42.2e-1590133146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+  ++++++++G++ W++ a++++ gRt++++k++w++
  Vradi01g09750.1  90 KGAFTAEEERFIAELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 133
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.9353284IPR017930Myb domain
SuperFamilySSF466897.86E-2936131IPR009057Homeodomain-like
SMARTSM007171.6E-133686IPR001005SANT/Myb domain
PfamPF002493.6E-153784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-223890IPR009057Homeodomain-like
CDDcd001673.10E-103984No hitNo description
PROSITE profilePS5129424.5385139IPR017930Myb domain
SMARTSM007178.5E-1689137IPR001005SANT/Myb domain
PfamPF002491.3E-1490133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2491138IPR009057Homeodomain-like
CDDcd001672.43E-1192133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MGRVNNEIED EVLPSDMSAA QSNGESYEGS TSVVLKKGPW TSTEDDILVD YVNKNGEGNW  60
NAVQKHTGLL RCGKSCRLRW ANHLRPNLKK GAFTAEEERF IAELHAKMGN KWARMAAHLP  120
GRTDNEIKNY WNTRIKRRQR AGLPLYPPEV SLQGFQESQR NQSNGGLNGG NRMHLDMLQK  180
NSYEIHGGIF DSLKDNQGIL PYAPKFSDVS VCGNMLKGLD SSSQYCSIMP PASPKNKRLR  240
ESTIQFTGSK DKKNNGLYPL CQNRDNNSDK IAHSFGMQAL LDPGPSSHNS MCYSHSLSNG  300
NSSTSKPTFE AVKLELPSLQ YPELHLGSWG TSPPPPMLES VDDFFQSHTP ISTLESDCSS  360
PQNSGLLDAL LYQAKTLSSS RNHCSDKGSN SSTATPGDRG DNSALNVYET EWEDYADPVS  420
PFGATSILNE CPALIGSENS LDEQLSLQTF TGNIPKLEFV DQVWTPDSEN QTLSFLNFTR  480
PDLLFASDWH ELGFGHGKNQ AITTDTTTTL LGDDFVADHK HMTSGTSQSS QVWGFGSCAS  540
AANNMHALCH LSDLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30351385107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014507919.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_014507995.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_014508071.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_014508146.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_014508219.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A0S3SAG60.0A0A0S3SAG6_PHAAN; Uncharacterized protein
STRINGGLYMA13G25716.10.0(Glycine max)
STRINGGLYMA15G35860.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-110myb domain protein 65